PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G23090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 425aa    MW: 45462.9 Da    PI: 6.1361
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G23090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS260.27.4e-80374232374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvsely..kalppsetsekn...sseelaalkl..fsevs 88 
                      ++lLl+cA a++s+d +laq++++ l+++as++gdp qRl++ +++AL ar  r +      +a++  e    +     +++++++l  +++++
  ORUFI05G23090.1  37 QQLLLHCAAALESNDVTLAQQAMWVLNNIASSQGDPSQRLTSWLLRALVARACRLCAAAPagAAVEFLERG--RappWGRAMSVTELadYVDLT 128
                      699***************************************************44443300333333333..2356555555566688***** PP

             GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefn 179
                      P+++f++ + N aIl+av+g+++vH++D+++++++QWp+L++ L++Rp+g+p +RiT+ +   ++    + + +e+g rLa fA++ gv++efn
  ORUFI05G23090.1 129 PWHRFGFTASNAAILRAVAGASAVHVVDLSVTHCMQWPTLIDVLSKRPGGAPAIRITVPSVRPAVpplLAVSSSELGARLAIFAKSKGVQLEFN 222
                      *********************************************************9887555578889999********************* PP

             GRAS 180 vl..............vakrledl..eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerf 257
                      v+              ++++l+++  ++ +L ++ gEa++Vn++  l ++       +++rd +L++v+ l+P +v+v++++ad++s+s++ r+
  ORUFI05G23090.1 223 VVesatttspkktsttLCQELASVlsDPPSLGLRDGEAVVVNCQSWLRHVA------PDTRDLFLDTVRALNPCLVTVTDEDADLGSPSLASRM 310
                      **998888776655443344443367888889999************9998......66789******************************** PP

             GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                      + ++++++ l+d+l++++p++s  r   E++ +gr+i++v+  e  +  er e  ++  er+++ GF  v ++e+aa+++++ll++++  g+ v
  ORUFI05G23090.1 311 AGCFDFHWILLDALDMSAPKDSPRRLEQEAA-VGRKIESVIGEEDGA--ERSEPGARLAERMSRKGFAGVVFDEEAAAEVRRLLSEHA-TGWGV 400
                      *************************999999.**********99988..9**************************************.99*** PP

             GRAS 352 eeesgslvlgWkdrpLvsvSaWr 374
                      + e++ lvl+Wk+++ v++ aW+
  ORUFI05G23090.1 401 KREDDMLVLTWKGHAAVFTGAWT 423
                      **********************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.78710404IPR005202Transcription factor GRAS
PfamPF035142.6E-7737423IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MDMEHELRGG CVGAAAHGHG SICFSGGPVL VDGRRIQQLL LHCAAALESN DVTLAQQAMW  60
VLNNIASSQG DPSQRLTSWL LRALVARACR LCAAAPAGAA VEFLERGRAP PWGRAMSVTE  120
LADYVDLTPW HRFGFTASNA AILRAVAGAS AVHVVDLSVT HCMQWPTLID VLSKRPGGAP  180
AIRITVPSVR PAVPPLLAVS SSELGARLAI FAKSKGVQLE FNVVESATTT SPKKTSTTLC  240
QELASVLSDP PSLGLRDGEA VVVNCQSWLR HVAPDTRDLF LDTVRALNPC LVTVTDEDAD  300
LGSPSLASRM AGCFDFHWIL LDALDMSAPK DSPRRLEQEA AVGRKIESVI GEEDGAERSE  360
PGARLAERMS RKGFAGVVFD EEAAAEVRRL LSEHATGWGV KREDDMLVLT WKGHAAVFTG  420
AWTPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-28364224374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1133320.0AC113332.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1057_B02, complete sequence.
GenBankAC1305970.0AC130597.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0017K09, complete sequence.
GenBankAK0704890.0AK070489.1 Oryza sativa Japonica Group cDNA clone:J023050L12, full insert sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638716.10.0PREDICTED: scarecrow-like protein 32
TrEMBLA0A0E0PPK60.0A0A0E0PPK6_ORYRU; Uncharacterized protein
STRINGORGLA05G0190100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122273238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.12e-96GRAS family protein